Analytical Data
-
Gene name
CLEC4D
- Application
-
Alternative Names
CLEC4D;CLECSF8;MCL;C-type lectin domain family 4 member D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXI8
-
Expression Region
39-215aa
-
AA Sequence
CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
-
Molecular Weight
36.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLEC4D, a member of the C-type lectin receptor family, has garnered significant attention in immunology and molecular biology due to its role in mediating immune responses. Expressed predominantly on dendritic cells and macrophages, CLEC4D is involved in the recognition of various pathogens, including viruses and fungi, thereby influencing innate and adaptive immunity. Its ability to bind specific carbohydrate structures on pathogens suggests a critical function in pathogen recognition and immune signaling. Recent studies have highlighted CLEC4D's involvement in the modulation of inflammatory responses and its potential as a therapeutic target for autoimmune diseases and infections. Understanding the structural and functional properties of CLEC4D, especially through techniques like protein reconstitution and crystallography, is essential for elucidating its mechanisms of action. The reorganization of CLEC4D on cellular membranes during immune activation may also provide insights into its signaling pathways. As research progresses, CLEC4D could emerge as a pivotal player in the development of immunotherapeutic strategies, further emphasizing its relevance in both basic and translational research within the field of immunology.











