Cat: PA1000-7243

Recombinant Human FETUB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FETUB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FETUB;Fetuin-B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UGM5

  • Expression Region

    16-382aa

  • AA Sequence

    CGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLN RVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYG QCKAIFYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNH QVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESP CTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATG SENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNS QEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPKEKART AECPGPAQNASPLVLPP

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FETUB, the FETU-binding protein, is a crucial protein involved in iron metabolism and transport within the human body. Research into FETUB has gained significance due to its potential implications in various physiological and pathological conditions, particularly those related to iron homeostasis. Alterations in FETUB expression have been associated with disorders such as hemochromatosis, anemia, and other iron overload diseases. As a binding partner for transferrin and other iron-regulating factors, FETUB plays a vital role in modulating cellular iron levels, influencing both systemic and local iron distribution. Investigations into the structure and function of FETUB can illuminate its regulatory mechanisms and interactions, providing insights into how iron balance is maintained at the cellular level. Given that iron is essential for numerous biological processes but can be toxic in excess, understanding FETUB's role may pave the way for novel therapeutic strategies targeting iron-related disorders. The recombinant production of FETUB facilitates detailed studies on its biochemical properties, interactions, and potential impacts on iron metabolism, furthering our understanding and opening new avenues for clinical applications in managing diseases associated with dysregulated iron homeostasis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US