Analytical Data
-
Gene name
SELL
- Application
-
Alternative Names
SELL；P-selectin glycoProtein ligand 1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18337
-
Expression Region
190-332aa
-
AA Sequence
QCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAET QCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNC SEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SELL, also known as Siglec-10, is a member of the sialic acid-binding immunoglobulin-type lectins family, which plays a crucial role in immune regulation. Research into SELL has gained momentum due to its significant involvement in various biological processes, including cell adhesion, immune response modulation, and pathogen recognition. Its expression is mainly observed in myeloid cells and some lymphocytes, implicating it in the regulation of immune cell interactions. Notably, SELL has been linked to the prevention of autoimmune diseases and the modulation of inflammatory responses, making it a potential therapeutic target in treating conditions like cancer, infections, and other immune-related disorders. The structural characterization and functional analysis of SELL have revealed its unique binding properties and interactions with sialylated molecules, which are critical for its role in cellular signaling and immune evasion by pathogens. Consequently, the study of SELL as a recombinant protein is vital for developing new diagnostic tools and therapeutic strategies aimed at manipulating the immune system. Researchers are increasingly focusing on the recombinant expression of SELL to elucidate its mechanisms of action and explore its potential applications in immunotherapy. Understanding the nuances of SELL's function can lead to innovative approaches in harnessing the immune system, paving the way for advances in medical science that could significantly impact disease management and therapy.
