Cat: IPD-X14343

Recombinant Rat TNF RI/TNFRSF1A Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNF RI/TNFRSF1A

  • 简介

    TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNFRSF1A Protein, Rat (HEK293, His) is expressed by HEK293 and has a transmembrane region (M1-A211) with a His tag at the C-terminus[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tumor necrosis factor receptor superfamily member 1A; CD120a; TNF-R1; TNFRSF1A

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22934

  • Expression Region

    L30-A211

  • AA Sequence

    LVPSLGDREKRDNLCPQGKYAHPKNNSICCTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECTPCSHCKKNQECMKLCLPPVANVTNPQDSGTA

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    30-40 kDa due to glycosylation

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tumor necrosis factor receptor 1 (TNFRSF1A), also known as TNF receptor type 1 (TNF RI), is a critical component of the TNF superfamily, playing a pivotal role in mediating various biological responses, including inflammation, cell proliferation, and apoptosis. Dysregulation of TNF RI signaling is implicated in several pathological conditions, such as autoimmune diseases, cancer, and chronic inflammatory disorders. Given its significance, recombinant TNFRSF1A proteins have been a focus of research for their potential therapeutic applications. These recombinant proteins can be utilized to better understand the receptor's functional mechanisms, screen for novel drug candidates, and develop targeted therapies aimed at modulating TNF signaling pathways. The study of TNFRSF1A is crucial not only for its role in fundamental biology but also for its therapeutic potential in treating diseases associated with aberrant TNF signaling. Advances in recombinant DNA technology have facilitated the production of these proteins, enabling detailed structural and functional characterization. By exploring the interactions of TNFRSF1A with its ligands and downstream signaling pathways, researchers aim to uncover new insights that could lead to innovative treatments for a variety of diseases, thus underscoring the importance of continued investigation into this vital receptor.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US