Analytical Data
-
Gene name
DC-SIGN/CD209
-
简介
The DC-SIGN/CD209 protein is expressed on immature dendritic cells (DC) and is an important pathogen recognition receptor that initiates primary immune responses. It mediates endocytosis and subsequent degradation of pathogens within the lysosomal compartment. DC-SIGN/CD209 Protein, Human (HEK293, Fc) is the recombinant human-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Biological Activity
Measured by its ability of the immobilized protein to support the adhesion of CHO Chinese hamster ovary cells transfected with ICAM-3. The ED50 for this effect is 1.087 μg/mL, corresponding to a specific activity is 919.963 units/mg. Measured by its ability of the immobilized protein to support the adhesion of CHO Chinese hamster ovary cells transfected with ICAM-3. The ED50 for this effect is 1.087 μg/mL, corresponding to a specific activity is 919.963 units/mg.
-
Alternative Names
rHuCD209 antigen/CD209, Fc; CD209 molecule; CD209; CDSIGNHIV gpl20-binding protein; CLEC4L; DCSIGN; DC-SIGN; DC-SIGN1; CD209 Antigen
-
Species
Human
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NNX6-1
-
Expression Region
Q59-A404
-
AA Sequence
QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
-
Protein Length
Extracellular Domain
-
Molecular Weight
78 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Related Products
Protein Description
DC-SIGN (dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin), also known as CD209, is a C-type lectin receptor predominantly expressed on dendritic cells and macrophages. It plays a crucial role in the immune response by recognizing and binding to various pathogens, including viruses and bacteria, facilitating their uptake and subsequent presentation to T cells. Given its involvement in pathogen recognition and the modulation of immune responses, DC-SIGN has garnered significant interest for its potential applications in vaccine development and immunotherapy. Moreover, studies have shown that certain viruses, such as HIV and Ebola, exploit DC-SIGN to enhance their infectivity and evade the host immune system. Research on recombinant DC-SIGN/CD209 proteins aims to elucidate its structural and functional properties, paving the way for the design of targeted therapies and diagnostic tools. Understanding the interactions between DC-SIGN and its ligands, as well as its signaling pathways, could offer insights into strategies for controlling infections and modulating immune responses. The recombinant protein can also serve as a valuable tool in studying various aspects of dendritic cell biology and its implications in health and disease, ultimately contributing to the development of novel therapeutic approaches.











