Analytical Data
-
Gene name
CLLU1OS
- Application
-
Alternative Names
CLLU1OSPutative chronic lymphocytic leukemia up-regulated protein 1 opposite strand transcript protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5K130
-
Expression Region
1-101aa
-
AA Sequence
MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM
-
Molecular Weight
38.06 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLLU1OS is a long non-coding RNA (lncRNA) identified in the context of chronic lymphocytic leukemia (CLL), a common type of blood cancer characterized by the accumulation of malignant B lymphocytes. The exploration of CLLU1OS has emerged from an increasing understanding of the crucial roles that lncRNAs play in cancer biology, particularly in regulating gene expression, cellular proliferation, and apoptosis. Research indicates that aberrant expression of CLLU1OS is associated with disease progression in CLL, suggesting its potential as a biomarker for diagnosis and prognosis. Furthermore, the genomic context of CLLU1OS enhances its relevance, as it is located in an area linked to genomic instability and altered regulatory pathways in CLL cells. Advances in RNA sequencing technologies have facilitated the discovery of CLLU1OS, leading to investigations into its functional mechanisms and interactions within cellular networks. This has prompted researchers to consider the therapeutic potential of targeting CLLU1OS and its associated pathways in the development of novel treatment strategies for CLL. Understanding the molecular underpinnings of CLLU1OS may not only shed light on its role in carcinogenesis but also contribute to the broader field of cancer research, where lncRNAs are increasingly recognized as critical regulatory elements that could be targeted for therapeutic intervention. Overall, the study of CLLU1OS represents a promising frontier in CLL research, with implications for enhancing patient management and outcomes through precision medicine approaches.
