Cat: PA2000-6673

Recombinant Human CHD1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ATP dependent helicase CHD 1; ATP-dependent helicase CHD1; CHD 1; CHD-1; Chd1; CHD1_HUMAN; Chromodomain helicase DNA binding Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14646

  • Expression Region

    1177 -1272 a.a

  • AA Sequence

    IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS

  • Molecular Weight

    36.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CHD1 (Chromodomain Helicase DNA-binding protein 1) is a member of the CHD family of ATP-dependent chromatin remodelers, which play crucial roles in various cellular processes, including DNA replication, repair, and transcription regulation. Recent studies have implicated CHD1 in the maintenance of genome integrity and the epigenetic regulation of gene expression, highlighting its importance in development and cellular differentiation. Mutations and dysregulation of CHD1 have been associated with various cancers and genetic disorders, making it a potential therapeutic target. The recombinant study of CHD1 focuses on understanding its structural and functional properties, enabling researchers to explore its interaction with DNA and histones, as well as its role in chromatin dynamics. By producing CHD1 as a recombinant protein, researchers can investigate its enzymatic activity and binding properties in detail, which is essential for elucidating its mechanisms of action in chromatin remodeling. This research not only enhances our understanding of CHD1's biological functions but also paves the way for potential applications in cancer therapy and regenerative medicine, where restoring normal chromatin dynamics may mitigate disease progression. As such, recombination studies of CHD1 represent a significant endeavor in the field of molecular biology and cancer research, aimed at bridging the gap between basic science and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US