Analytical Data
-
Gene name
SC5DL
- Application
-
Alternative Names
SC5D; SC5DL; Lathosterol oxidase; C-5 sterol desaturase; Delta(7-sterol 5-desaturase; Delta(7-sterol C5(6-desaturase; Lathosterol 5-desaturase; Sterol-C5-desaturase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75845
-
Expression Region
1-299 aa
-
AA Sequence
MDLVLRVADYYFFTPYVYPATWPEDDIFRQAISLLIVTNVGAYILYFFCATLSYYFVFDHALMKHPQFLKNQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELVVSIISFLFFTDMFIYWIHRGLHHRLVYKRLHKPHHIWKIPTPFASHAFHPIDGFLQSLPYHIYPFIFPLHKVVYLSLYILVNIWTISIHDGDFRVPQILQPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSHSGNGCKNEKLFNGEFTKTE
-
Molecular Weight
61.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SC5DL, a member of the dolichol phosphate-mannose (DPM) synthase family, plays a crucial role in the biosynthesis of glycoproteins, which are essential for various cellular functions and structural integrity. The interest in SC5DL has surged due to its involvement in key biological processes, including protein folding, cellular signaling, and immune responses. Aberrations in SC5DL activity have been implicated in several disorders, including congenital disorders of glycosylation, leading to severe developmental and functional anomalies. Moreover, understanding the molecular mechanism of SC5DL can provide insights into its regulatory pathways and potential therapeutic targets for associated diseases. Research efforts are increasingly focused on the recombinant expression and characterization of SC5DL to elucidate its functional dynamics and interaction with substrates. The production of SC5DL as a recombinant protein enables a more detailed study of its enzymatic properties and the structural basis for its activity. This research not only enhances our fundamental understanding of glycoprotein biosynthesis but also holds promise for the development of novel therapeutic strategies aimed at correcting glycosylation defects. Overall, the study of SC5DL and its recombinant form represents a significant frontier in molecular biology and biotechnology, with potential implications in medical science and therapeutic innovations.
