Cat: PA1000-6652

Recombinant Human vWF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    vWF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    vWF;F8VWF;von Willebrand factor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04275

  • Expression Region

    1-273aa

  • AA Sequence

    MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSP RAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAG GCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPY ASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCG NFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNIS SGEMQKVGVDWPGCTWMVCDFWI

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Von Willebrand factor (vWF) is a crucial glycoprotein involved in hemostasis, playing a key role in platelet adhesion and aggregation at sites of vascular injury. Mutations or deficiencies in vWF can lead to bleeding disorders, most notably von Willebrand disease (vWD). The study of recombinant vWF has gained significant attention in recent years due to its potential therapeutic applications. Traditional treatments for vWD often include desmopressin or plasma-derived concentrates; however, these can have limitations such as variable responses and risks of pathogen transmission. Recombinant vWF, produced through genetic engineering techniques, offers a more controlled and safer alternative, with the possibility of optimizing its properties for enhanced efficacy. Research efforts have focused on developing robust expression systems and purification methods to yield high-quality vWF that retains its functional abilities. Furthermore, advances in biopharmaceutical technologies have allowed for the exploration of modified versions of vWF that could improve its stability and activity in therapeutic settings. Investigators are also exploring the mechanisms of vWF biology to better understand its role in various vascular conditions, aiming to translate these findings into novel treatments. Ultimately, the ongoing research on recombinant vWF not only aims to improve therapeutic options for vWD but also to deepen our understanding of hemostasis and vascular biology, paving the way for innovative strategies to manage bleeding disorders and related complications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US