Analytical Data
-
Gene name
vWF
- Application
-
Alternative Names
vWF;F8VWF;von Willebrand factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04275
-
Expression Region
1-273aa
-
AA Sequence
MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSP RAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAG GCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPY ASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCG NFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNIS SGEMQKVGVDWPGCTWMVCDFWI
-
Molecular Weight
56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Von Willebrand factor (vWF) is a crucial glycoprotein involved in hemostasis, playing a key role in platelet adhesion and aggregation at sites of vascular injury. Mutations or deficiencies in vWF can lead to bleeding disorders, most notably von Willebrand disease (vWD). The study of recombinant vWF has gained significant attention in recent years due to its potential therapeutic applications. Traditional treatments for vWD often include desmopressin or plasma-derived concentrates; however, these can have limitations such as variable responses and risks of pathogen transmission. Recombinant vWF, produced through genetic engineering techniques, offers a more controlled and safer alternative, with the possibility of optimizing its properties for enhanced efficacy. Research efforts have focused on developing robust expression systems and purification methods to yield high-quality vWF that retains its functional abilities. Furthermore, advances in biopharmaceutical technologies have allowed for the exploration of modified versions of vWF that could improve its stability and activity in therapeutic settings. Investigators are also exploring the mechanisms of vWF biology to better understand its role in various vascular conditions, aiming to translate these findings into novel treatments. Ultimately, the ongoing research on recombinant vWF not only aims to improve therapeutic options for vWD but also to deepen our understanding of hemostasis and vascular biology, paving the way for innovative strategies to manage bleeding disorders and related complications.











