Cat: PA2000-2863

Recombinant Bacillus subtilis ptsH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ptsH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ptsH;Phosphocarrier Protein HPr

  • Species

    Bacillus subtilis

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08877

  • Expression Region

    2-88aa

  • AA Sequence

    AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEETMKSEGLGE

  • Molecular Weight

    25.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PtsH recombinant protein is rooted in its critical role in cellular signaling and metabolic regulation in various organisms. PtsH, part of the phosphotransferase system (PTS), is involved in the transport and phosphorylation of carbohydrates, influencing energy production and glucose metabolism. Research has shown that PtsH acts as a signaling molecule, thereby modulating the activity of downstream pathways in response to nutrient availability. Its function is not limited to carbohydrate metabolism; it also plays a role in stress response and adaptation by influencing gene expression and protein interactions. Investigating PtsH at the molecular level through recombinant protein technologies enables researchers to isolate and characterize its specific interactions, understand its structural properties, and assess its functional implications in cellular processes. This has significant biotechnological potential, particularly in the development of microbial strains for industrial fermentation processes, where optimized carbohydrate metabolism can enhance productivity. Furthermore, studies on recombinant PtsH contribute to a broader understanding of bacterial physiology and can inform therapeutic strategies, especially in the context of pathogenic organisms that utilize similar metabolic pathways for survival and virulence. Thus, the investigation of PtsH and its recombinant forms provides valuable insights into fundamental biological processes and offers opportunities for applicable advancements in biotechnology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US