Analytical Data
-
Gene name
UVSX
- Application
-
Alternative Names
UVSX；Recombination and repair Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04529
-
Expression Region
1-391aa
-
AA Sequence
MSDLKSRLIKASTSKLTAELTASKFFNEKDVVRTKIPMMNIALSGEITGG MQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYL RSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLAS KKETEDALNEKVVSDMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTYETQ EMFSKTVMGGGTGPMYSADTVFIIGKRQIKDGSDLQGYQFVLNVEKSRTV KEKSKFFIDVKFDGGIDPYSGLLDMALELGFVVKPKNGWYAREFLDEETG EMIREEKSWRAKDTNCTTFWGPLFKHQPFRDAIKRAYQLGAIDSNEIVEA EVDELINSKVEKFKSPESKSKSAADLETDLEQLSDMEEFNE
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the UVSX protein, a vital component in the field of molecular biology, has gained traction due to its unique role in the response to ultraviolet (UV) radiation damage in cells. As organisms are constantly exposed to UV light, the ability to effectively repair or mitigate the effects of such damage is crucial for maintaining cellular integrity and preventing mutagenesis, which can lead to various diseases, including cancer. UVSX is part of the cellular repair machinery that recognizes and corrects DNA lesions caused by UV exposure. Researchers have focused on elucidating the structure and function of UVSX, as well as its interactions with other proteins involved in the DNA repair pathways. Through techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy, scientists have begun to uncover the molecular mechanisms by which UVSX operates, revealing insights into its potential as a target for therapeutic interventions. Understanding the role of UVSX in DNA repair not only enhances our comprehension of cellular defense mechanisms but also paves the way for advancements in genetic engineering and synthetic biology, where harnessing these natural processes could lead to innovative solutions for combating DNA damage-related disorders. Furthermore, the exploration of UVSX and similar proteins has significant implications for improving agricultural practices and developing UV-resistant crops, thus contributing to global food security in the face of increasing environmental stressors. Overall, the investigation of UVSX serves a dual purpose: it addresses fundamental biological questions while also holding promise for applied scientific advancements.
