Analytical Data
-
Gene name
rdgB
- Application
-
Alternative Names
rdgB;Cytoplasmic phosphatidylinositol transfer Protein 1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52061
-
Expression Region
1-197aa
-
AA Sequence
MQKVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAILKARHAAKVTALPAIADDSGLAVDVLGGAPGIYSARYSGEDATDQKNLQKLLETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTGGFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALRNG
-
Molecular Weight
41.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RdgB, a member of the RdgB family of proteins, plays a crucial role in various cellular processes, including signaling and membrane trafficking. It is primarily recognized for its significance in the regulation of phosphoinositide metabolism, which is essential for cellular responses to external stimuli. Research has shown that RdgB proteins can bind to specific lipids, influencing the membrane dynamics and cellular signaling pathways. Given its involvement in critical physiological processes, mutations or dysregulation of RdgB have been implicated in several diseases, making it a potential therapeutic target. Recent studies have focused on the recombinant production of RdgB proteins to facilitate detailed biochemical and structural analyses. The generation of recombinant RdgB allows for in vitro studies that can elucidate its functional mechanisms and interactions with other cellular components. Understanding RdgB's structure-function relationship can provide insights into its role in health and disease, potentially leading to the development of novel therapeutic strategies aimed at modulating its activity in pathological conditions. As such, the research surrounding RdgB recombinant proteins represents a significant area of interest in cell biology and molecular medicine.











