Analytical Data
-
Gene name
TOPK
- Application
-
Alternative Names
TOPK；TOPK；Lymphokine-activated killer T-cell-originated Protein kinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96KB5
-
Expression Region
1-322aa
-
AA Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
-
Molecular Weight
63.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TOPK (T-Lymphokine-Activated Protein Kinase) is a serine/threonine kinase that has gained attention in cancer research due to its role in cell proliferation, survival, and migration. Discovered as a protein that is activated by T-cell stimulation, TOPK is implicated in various cellular processes, including the regulation of the cell cycle and apoptosis. Overexpression of TOPK has been observed in several cancer types, such as breast, lung, and bladder cancers, suggesting its potential as a biomarker for tumor diagnosis and prognosis. Additionally, TOPK has been linked to the activation of key signaling pathways like MAPK/ERK and PI3K/Akt, which are critical for cancer progression. Researchers are investigating TOPK not only as a therapeutic target for cancer treatments but also as a tool for understanding tumor biology. Innovations in recombinant protein technology have facilitated the production of TOPK for structural and functional studies, aiming to elucidate its mechanisms at the molecular level. The ongoing research highlights the importance of TOPK in understanding tumorigenesis and the potential for developing targeted therapies that could improve patient outcomes in malignancies where TOPK is dysregulated.
