Analytical Data
-
Gene name
C9orf139
- Application
-
Alternative Names
C9orf139Uncharacterized Protein C9orf139
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZV77
-
Expression Region
1-190aa
-
AA Sequence
MALRGHPEPQPTNTPLSATVGGPISLFTQPRCHSAARDLVWSQAWPDPDVLEISMQTPGGSSCRKEAVLPRLRVTRPLVPEPAILPVCAARLAGSLATDLSRSHSLLPPWVDLKEPPPPSAPSLLLEDPGQGGCHGAQSCVGTCELANGARGFCPEMGQNESLSEEREGHESKRKSGGRGSPSSHPTQAS
-
Molecular Weight
20.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf139, a gene located on chromosome 9, has recently garnered attention in the field of molecular biology and genetics due to its potential implications in cellular functions and disease mechanisms. Initial studies have suggested that C9orf139 may play a role in various biological processes, including cell proliferation and apoptosis. Further investigation has indicated a possible association between C9orf139 and neurodegenerative diseases, such as amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD), particularly through its links to hexanucleotide repeat expansions in the C9orf72 gene. As a result, researchers are now focusing on the recombinant protein forms of C9orf139 to explore its structural and functional properties, aiming to elucidate the protein's role in disease pathology and cellular signaling pathways. The development of recombinant C9orf139 proteins enables the study of its interactions with other biomolecules and the potential to elucidate its mechanisms of action at the molecular level. Understanding C9orf139's function and its relationships with neurodegenerative processes may lead to the identification of novel therapeutic targets and strategies for intervention. Thus, ongoing research involving recombinant C9orf139 is crucial for advancing our comprehension of its biological significance and its potential impact on human health.
