Analytical Data
-
Gene name
caf1
- Application
-
Alternative Names
caf1；CAF；CAF1P150；Chromatin assembly factor 1 subunit A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UFF9
-
Expression Region
1-292aa
-
AA Sequence
MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
-
Molecular Weight
60.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Caf1 is a critical protein involved in various cellular processes, particularly in the realm of RNA metabolism and regulation. As a component of the Ccr4-Not complex, Caf1 plays a vital role in mRNA deadenylation, a key step in the control of gene expression, influencing both mRNA stability and degradation. The study of Caf1 and its associated pathways has gained significant attention due to its implications in developmental biology, cancer, and other diseases. Researchers are particularly interested in understanding how Caf1 interacts with other protein complexes and RNA substrates, as well as its mechanism of action in regulating gene expression. Moreover, the ability of Caf1 to influence cellular responses to environmental stimuli highlights its potential as a target for therapeutic interventions. By examining the structure-function relationships of Caf1 and its interactions within cellular pathways, scientists aim to elucidate the broader regulatory networks it participates in, ultimately contributing to a more comprehensive understanding of cellular homeostasis and disease mechanisms. The investigation of Caf1 thus not only provides insights into fundamental biological processes but also opens avenues for developing novel strategies in disease treatment and gene therapy.
