Analytical Data
-
Gene name
HA-33
- Application
-
Alternative Names
HA-33；HHA3-I；HKA3A；KRTHA3A；Keratin. type I cuticular Ha3-I
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DPR0
-
Expression Region
2-286aa
-
AA Sequence
SQTNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYKIKVMDNTSLILTWNAPLSSVSVKTDTNGDNQYWYLLQNYISRNVIIRNYMNPNLVLQYNIDDTLMVSTQTSSSNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQIANGTHVIVDSYHGNTNQQWIINLI
-
Molecular Weight
53.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The HA-33 recombinant protein is derived from the human CD33 antigen, a type of glycoprotein found on the surface of various immune cells, particularly myeloid cells. CD33 plays a critical role in the regulation of immune responses and is implicated in several hematological malignancies, including acute myeloid leukemia (AML). The study of HA-33 has gained prominence due to its potential as a therapeutic target in cancer treatment. Researchers have focused on understanding the structure and function of HA-33 to develop effective monoclonal antibodies and immunotherapies aimed at inhibiting its expression or function. By leveraging recombinant DNA technology, scientists can produce HA-33 in significant quantities, facilitating detailed studies of its role in tumor biology and its interactions with other immune modulators. Importantly, the insights gained from HA-33 research could lead to the development of targeted therapies that improve patient outcomes in hematologic cancers and enhance our understanding of the CD33 signaling pathway. Overall, HA-33 represents a promising avenue for advancing cancer immunotherapy and offers a framework for exploring new treatments that could revolutionize current approaches to cancer management.
