Analytical Data
-
Gene name
phyA
- Application
-
Alternative Names
phyA;Phytase A
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P34752
-
Expression Region
24-467aa
-
AA Sequence
ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA
-
Molecular Weight
50.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Phytochrome A (phyA) is a critical photoreceptor in plants that mediates various light signaling pathways, influencing growth, development, and photomorphogenesis. As a member of the phytochrome family, phyA is primarily responsive to far-red light and plays a pivotal role in regulating gene expression in response to environmental light conditions. The activation of phyA involves a conformational change triggered by light absorption, leading to its interaction with signaling proteins that initiate downstream responses. Understanding the structure and function of phyA is crucial for elucidating the molecular mechanisms underlying plant photoreception and adaptive behavior to light environments. Recent advances in recombinant protein technologies have facilitated the production of functional phyA, allowing researchers to investigate its photochemical properties, stability, and interaction dynamics with various partners. Such studies can provide insights into how phyA orchestrates signal transduction processes and affects plant phenotype, particularly in response to changing light conditions. Research on recombinant phyA also holds potential applications in agriculture, as manipulating its pathways may improve crop resilience and yield under varying light regimes. Thus, the investigation of phyA as a recombinant protein represents a significant step toward unraveling the complexities of plant light signaling and enhancing agricultural practices through biotechnological approaches.











