Analytical Data
-
Gene name
pbpE
- Application
-
Alternative Names
pbpE；GRIK；Glutamate receptor ionotropic. kainate 4
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32959
-
Expression Region
1-451aa
-
AA Sequence
MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK
-
Molecular Weight
67.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PbpE (penicillin-binding protein E) is an essential protein involved in bacterial cell wall synthesis, making it a potential target for antibiotic development. As a member of the penicillin-binding protein family, PbpE plays a crucial role in the biogenesis and maintenance of peptidoglycan, a key component of bacterial cell walls that provides structural integrity. Research into PbpE has gained momentum due to the rising concern of antibiotic resistance, which poses significant challenges to public health. Understanding the structure and function of PbpE can offer insights into its mechanism of action and how it interacts with various antibiotics. Additionally, the exploration of PbpE as a recombinant protein allows for the investigation of its properties in a controlled environment, facilitating the development of novel antibacterial strategies. Through techniques such as protein expression, purification, and functional assays, scientists aim to elucidate the specific roles of PbpE in bacterial physiology and its potential as a target for new antimicrobial agents. The ongoing research into PbpE could significantly contribute to the discovery of innovative treatments to combat resistant bacterial infections and enhance our understanding of bacterial cell wall synthesis.
