Cat: PA2000-2584

Recombinant Bacillus subtilis tcyA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    tcyA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    tcyA;yckK;L-cystine-binding Protein TcyA

  • Species

    Bacillus subtilis

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P42199

  • Expression Region

    20-268aa

  • AA Sequence

    CGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK

  • Molecular Weight

    29.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The tcyA gene, which encodes a component of the cysteine biosynthesis pathway, has garnered significant attention in recombinant protein research due to its critical role in cellular metabolism and stress response in various organisms. Cysteine is a key amino acid that serves as a building block for proteins, a precursor for important biomolecules, and plays a vital role in antioxidant defense mechanisms. Understanding the function and regulation of tcyA can provide insights into metabolic pathways and stress adaptations in microbes, plants, and potentially higher organisms. Research has shown that manipulating the expression of tcyA can enhance cysteine production, which is beneficial for biotechnological applications, including the production of nutraceuticals and pharmaceuticals. Furthermore, as cysteine can affect the synthesis of glutathione, a major antioxidant, studying tcyA may also illuminate strategies for improving stress tolerance in agricultural crops, aiding in food security. Advances in recombinant DNA technology have facilitated the cloning and expression of tcyA, allowing researchers to investigate its functional characteristics and interactions within cellular pathways. Overall, the study of tcyA as a recombinant protein presents an exciting avenue for both fundamental research and practical applications in biotechnology and agriculture.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US