Analytical Data
-
Gene name
C6orf114
- Application
-
Alternative Names
Glucose-fructose oxidoreductase domain-containing Protein 1. Gfo/Idh/MocA-like oxidoreductase domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NXC2
-
Expression Region
1-136aa
-
AA Sequence
MGDSRRDVLHEPAIALLSSPQTQSRLQIDAFIARRCWGSQWDITGYIHQQDFPTAVFIGFSNEFNICIPHPFTEWLQCVRKYSQSWGVRKGQRHIRYGMCSERTHHLSRTYSSLLEREEKLAFYGVLTMCQIWSET
-
Molecular Weight
42.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf114, also known as Chromosome 6 Open Reading Frame 114, is a relatively uncharacterized protein that has gained attention in recent years due to its potential roles in various biological processes. It is located on chromosome 6 and is part of a family of proteins that have been implicated in cell signaling, immune responses, and possibly in the development of certain diseases, including cancers. The interest in studying C6orf114 has been fueled by the identification of its expression in various tissues, suggesting a functional role that warrants further investigation. Additionally, emerging evidence indicates that C6orf114 may interact with other proteins, contributing to cellular functions such as apoptosis and proliferation. The recombinant expression of C6orf114 facilitates a deeper understanding of its structural and functional properties, allowing researchers to explore its involvement in metabolic and signaling pathways. Understanding the mechanisms and roles of C6orf114 could not only provide insights into fundamental biological processes but also uncover its potential as a therapeutic target or biomarker in diseases. Thus, research on recombinant C6orf114 is essential for elucidating its function and relevance in health and disease.
