Analytical Data
-
Gene name
C5orf40
- Application
-
Alternative Names
Fibronectin type III domain-containing Protein 9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBE3
-
Expression Region
1-224aa
-
AA Sequence
MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHNEEKVPRTISSVVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAILLACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGALQRGGGDPPAILPHCGE
-
Molecular Weight
51.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C5orf40, also known as Chromosome 5 Open Reading Frame 40, is a relatively uncharacterized protein whose significance has come to light in recent years due to its potential roles in various biological processes and disease mechanisms. As a member of the family of proteins associated with intracellular signaling and gene regulation, C5orf40 has been implicated in several pathways that are critical for cellular homeostasis. Preliminary studies suggest that alterations in C5orf40 expression may be linked to certain cancers and other metabolic disorders, although the underlying mechanisms remain poorly understood. The availability of recombinant C5orf40 protein allows for detailed in vitro studies that can elucidate its functional roles and interactions within cellular environments. Understanding the structure-function relationship of C5orf40 is essential for determining its biological relevance and therapeutic potential. Given the growing interest in unexplored proteins like C5orf40, research focused on its recombinant form is paving the way for novel insights into its contribution to human health and disease, including its potential as a biomarker or drug target.
