Cat: PA2000-2482

Recombinant E.coli prn Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    prn

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    prn;MBN;Myeloblastin

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14283

  • Expression Region

    41-142aa

  • AA Sequence

    IVKTGERQHGIHIQGSDPGGVRTASGTTIKVSGRQAQGILLENPAAELQFRNGSVTSSGQLSDDGIRRFLGTVTVKAGKLVADHATLANVGDTWDDDGIALY

  • Molecular Weight

    17.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PRN recombinant proteins are increasingly significant in the fields of biotechnology and medicine due to their diverse applications, including therapeutic uses, vaccine development, and diagnostic tools. PRN, or protein-recognition-neighbor, refers to a class of proteins that play critical roles in immune response and cellular mechanisms. The production of PRN recombinant proteins involves the use of genetic engineering techniques to insert the gene encoding the desired protein into host cells, such as bacteria or yeast, which then express the protein in large quantities. This approach offers several advantages, including the ability to produce complex proteins that might be difficult to obtain from natural sources, ensuring consistency and purity in production. Recent advancements in synthetic biology and proteomics have further enhanced the efficiency of PRN protein production and characterization. Researchers are exploring the immunogenic properties of these proteins to design novel vaccines, particularly against infectious diseases and cancers. Additionally, the study of PRN recombinant proteins contributes to our understanding of protein-protein interactions and their implications in various biological processes, paving the way for new therapeutic strategies. Overall, the ongoing research into PRN recombinant proteins holds immense potential for improving healthcare outcomes and developing innovative solutions to pressing medical challenges.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US