Analytical Data
-
Gene name
GRA1
- Application
-
Alternative Names
GRA1；Glycine receptor subunit alpha-1
-
Species
Toxoplasma
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13403
-
Expression Region
25-190aa
-
AA Sequence
AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE
-
Molecular Weight
19.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRA1 (Gene Regulation Associated protein 1) is a key protein involved in various cellular processes, particularly in the regulation of gene expression and cellular signaling pathways. Research into GRA1 has gained momentum in recent years due to its potential implications in understanding the molecular mechanisms underlying various diseases, including cancer and neurodegenerative disorders. Studies indicate that GRA1 may play a crucial role in modulating the activity of transcription factors, influencing gene expression patterns, and thereby affecting cellular responses to environmental stimuli. Furthermore, the understanding of GRA1's structure and function can provide insights into its role in protein-protein interactions, potentially unveiling novel therapeutic targets. The exploration of GRA1's recombinant protein variants enables researchers to dissect its functional domains, enhance our understanding of its regulatory mechanisms, and assess its potential in biotechnological applications. As the field of molecular biology progresses, the investigation of GRA1 continues to be a significant area of focus, promising new avenues for research and therapeutic advancements.
