Cat: PA2000-2454

Recombinant Human Mup2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Mup2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Mup2;Major urinary Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11589

  • Expression Region

    19-180aa

  • AA Sequence

    EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

  • Molecular Weight

    20.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Mup2 recombinant protein research focuses on the Mup2 gene, which encodes a major urinary protein in rodents, particularly in mice. These proteins play crucial roles in pheromone signaling and the communication of social and reproductive cues among individuals. The study of Mup2 is significant as it helps to elucidate the mechanisms of olfactory communication and its influence on behavior. In the context of laboratory research, Mup2 serves as a model for understanding the complexities of protein interactions within the olfactory system. Additionally, the recombinant production of Mup2 allows for detailed structural and functional analysis, which can enhance our understanding of how these proteins interact with odorants and receptors. Investigating Mup2 not only provides insights into evolutionary biology and animal behavior but also has potential implications in the development of new methods for controlling pest populations through pheromone manipulation. Furthermore, advancements in recombinant DNA technology have made it feasible to produce Mup2 in various expression systems, facilitating studies on its biological activity and potential applications in biotechnology and medicine. This research background underscores the importance of Mup2 in both ecological and biomedical contexts, offering a multidisciplinary approach to understanding protein function and its implications in natural and artificial systems.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US