Analytical Data
-
Gene name
pac
- Application
-
Alternative Names
pac；PAC1；Dual specificity Protein phosphatase 2
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13249
-
Expression Region
1-199aa
-
AA Sequence
MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA
-
Molecular Weight
37.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Pac (Protein Antigenic Complex) recombinant proteins have gained significant attention in the field of molecular biology and immunology due to their potential applications in vaccine development and disease diagnostics. The need for effective vaccines and accurate diagnostic tools has driven researchers to explore various recombinant protein technologies. Pac proteins are particularly fascinating because they can enhance the immunogenicity of antigens, thereby improving the immune response. Additionally, the ability to produce these proteins in a controlled environment allows for the generation of consistent and high-purity materials, which are crucial for clinical applications. Previous studies have shown that the incorporation of adjuvants or the use of specific delivery systems in conjunction with Pac proteins can further boost their efficacy. As infectious diseases and emerging pathogens continue to pose global health challenges, the investigation of Pac recombinant proteins offers promising avenues for developing novel therapeutics and preventive measures. The ongoing research aims to understand the mechanisms of action, optimize production methods, and evaluate the safety and efficacy of these proteins in preclinical and clinical settings, reflecting a significant step forward in the quest for innovative solutions in public health.
