Analytical Data
-
Gene name
C2orf28
- Application
-
Alternative Names
ATRAID; APR3; C2orf28; HSPC013; UNQ214/PRO240; All-trans retinoic acid-induced differentiation factor; Apoptosis-related Protein 3; APR-3; p18
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UW56
-
Expression Region
1-171aa
-
AA Sequence
MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
-
Molecular Weight
44.55 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C2orf28, also known as Chromosome 2 open reading frame 28, is a gene of increasing interest in the field of molecular biology due to its potential implications in various cellular processes and diseases. Initial studies suggested that C2orf28 is involved in fundamental biological functions, including cell proliferation and differentiation. Its protein product has been implicated in pathways associated with cellular stress responses and may play a role in maintaining genome stability. Recent research highlights its potential as a biomarker for certain cancers, where altered expressions of C2orf28 were observed. Additionally, the reconstitution of C2orf28 as a recombinant protein allows for detailed biochemical characterization, facilitating insights into its structure-function relationships and interactions with other cellular components. Understanding the molecular mechanisms of C2orf28 can reveal its role in disease pathogenesis and may open avenues for therapeutic interventions. The exploration of C2orf28's functions and its interactions within cellular pathways represents a significant step toward comprehensively understanding the molecular underpinnings of health and disease.
