Analytical Data
-
Gene name
C22orf41
- Application
-
Alternative Names
SYCE3; C22orf41; THEG2; Synaptonemal complex central element Protein 3; Testis highly expressed gene 2 Protein; THEG-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1L190
-
Expression Region
1-88aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL
-
Molecular Weight
12.8 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C22orf41, a gene located on chromosome 22, encodes a protein that has garnered interest due to its potential role in various biological processes and pathologies. Recent studies have implicated C22orf41 in cellular stress responses and its involvement in diseases such as cancer and neurodegenerative disorders. The protein is thought to interact with multiple cellular pathways, making it a candidate for understanding disease mechanisms and therapeutic targets. However, knowledge regarding its structure, function, and regulation remains limited. Consequently, the recombination and production of C22orf41 protein serve as critical steps in elucidating its biological roles. By generating recombinant C22orf41 protein, researchers aim to investigate its biochemical properties, interactions with other proteins, and functional implications in cell signaling and disease contexts. This research could pave the way for innovative strategies in drug development and therapeutic interventions, particularly in conditions where C22orf41 may play a contributory role. Enhancing our understanding of C22orf41 through recombinant protein studies holds promise for uncovering novel insights into human health and disease.
