Analytical Data
-
Gene name
C21orf7
- Application
-
Alternative Names
MAP3K7CL; C21orf7; TAK1LMAP3K7 C-terminal-like Protein; TAK1-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57077
-
Expression Region
1-142aa
-
AA Sequence
MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS
-
Molecular Weight
32.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C21orf7, a gene located on chromosome 21, has garnered interest in recent years due to its potential relevance in various biological processes and diseases. This gene encodes a protein that is implicated in cellular functions such as apoptosis, cellular proliferation, and immune response, making it a candidate for studies related to cancer and autoimmune diseases. The exploration of C21orf7 as a recombinant protein has been driven by its unique structural and functional properties, which may offer insights into its role in disease mechanisms. Advances in recombinant DNA technology have enabled researchers to produce C21orf7 in sufficient quantities, allowing for detailed biochemical characterization and functional assays. This research could also help in understanding the gene's involvement in Down syndrome, given its location on chromosome 21, and its potential interactions with other genetic factors. Furthermore, studying C21orf7 may reveal new therapeutic targets or biomarkers, contributing to the development of innovative treatment strategies. Overall, the recombinant protein study of C21orf7 represents a promising frontier in biomedical research, with implications for understanding complex diseases and advancing personalized medicine.
