Cat: PA2000-2416

Recombinant E.coli lktA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    lktA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    lktA;AaLta;lktA;Leukotoxin

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55118

  • Expression Region

    1-229aa

  • AA Sequence

    MGNKLTNISTNLKSSWLTAKSGLNRTGQSLAKAGQSLKTGAKKIILYIPKDYQYDTEKGNGLQDLVKAAEELGIEVQKEEGNDIAKAQTSLGTIQNVLGLTERGIVLSAPQLDKLLQKTKVGQAIGSAENLTKGFSNAKTVLSGIQSILGSVLAGMDLDEALQKNSNELTLAKAGLELTNSLIENIANSVKTLDAFGDQINQLGSKLQNVKGLSSLGDKLKGLSGFDKT

  • Molecular Weight

    29.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LktA, a novel protein derived from the bacterium *Listeria monocytogenes*, has garnered significant interest in the field of microbiology and biotechnology due to its potential applications in vaccine development and therapeutic interventions. As a critical virulence factor, LktA plays a crucial role in the pathogenicity of *Listeria*, facilitating the bacterium's ability to evade host immune responses. Its unique structure and enzyme activity have led researchers to explore its role in bacterial survival and infection mechanisms. Advances in recombinant DNA technology have enabled the production of LktA as a recombinant protein, allowing for detailed biochemical characterization and functional studies. The ability to manipulate this protein in vitro provides insights into its immunogenic properties, potentially aiding in the formulation of protein-based vaccines. Moreover, understanding the regulatory pathways associated with LktA may uncover new targets for antimicrobial drug development. Research into LktA not only enhances our understanding of *Listeria* pathogenesis but also holds promise for innovative therapeutic strategies to combat infections caused by this and other related bacterial pathogens. The ongoing exploration of LktA's molecular function and its interaction with host immune cells is crucial for developing new biomedical applications and improving public health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US