Analytical Data
-
Gene name
C20orf3
- Application
-
Alternative Names
Adipocyte plasma membrane associated Protein; Adipocyte plasma membrane-associated Protein; apmap; APMAP_HUMAN; BSCv; BSCv Protein; C20orf3; Chromosome 20 open reading frame 3; Protein BSCv
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HDC9
-
Expression Region
1-416aa
-
AA Sequence
MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV
-
Molecular Weight
46.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf3, also known as "Chromosome 20 open reading frame 3," is a gene located on chromosome 20 that has garnered increasing interest in the field of molecular biology and genetics due to its potential implications in various diseases, particularly cancer. Recent studies have suggested that the protein encoded by C20orf3 may play a significant role in cellular processes, including proliferation, differentiation, and apoptosis. Researchers have been investigating the structure and function of the C20orf3 recombinant protein to better understand its biological significance and its potential as a therapeutic target. The generation of recombinant C20orf3 protein allows for detailed biochemical analyses, such as examining its interaction with other cellular components, enzymatic activity, and its involvement in signaling pathways. Preliminary findings have indicated that alterations in C20orf3 expression can affect tumor growth and response to treatment, highlighting its potential role in cancer progression. The ongoing research aims to elucidate the mechanistic details of C20orf3's function, paving the way for future studies that could lead to novel diagnostic or therapeutic strategies for cancer and other related diseases.
