Analytical Data
-
Gene name
PSRC2
- Application
-
Alternative Names
Zinc finger C3H1 domain-containing protein. Coiled-coil domain-containing protein 131. Proline/serine-rich coiled-coil protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60293
-
Expression Region
1-358 aa
-
AA Sequence
MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQIRSRSSSSSSGGGLLPYPRRRPPHSARGGGSGGGGGSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYRPKEPFRSHPPSVRMPSSSLSESSPRPSFWERSHLALDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPPLGGGAGSGFSSSQSWREPSPPRKSSKSFGRSPSRKQNYSSKNENCVEETFEDLLLKYKQIQLELECINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFELKPLRQKLTLPGDKNRLKKVKDGAKPLSLKSDTTDSSQGIPYRVKEGFTPIPGLKFSA
-
Molecular Weight
65.12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSRC2 (Proline-Serine-Rich Coiled-Coil Protein 2) is a member of a growing family of coiled-coil proteins that play crucial roles in various cellular processes, including cell proliferation, differentiation, and signaling. Recent studies have highlighted the importance of PSRC2 in the regulation of gene expression and its potential involvement in disease pathways, particularly in cancer. The protein is thought to interact with various transcription factors and chromatin remodeling complexes, thereby influencing cellular responses to extracellular signals. The understanding of PSRC2's structure and function is vital for uncovering its role in cellular mechanisms and its potential as a therapeutic target. Current research focuses on the recombinant expression of PSRC2 to elucidate its biochemical properties and functional interactions. This includes producing the protein in suitable expression systems, such as bacteria or yeast, and characterizing its interactions with known partners and regulatory elements. By leveraging advanced techniques such as protein purification, structural biology, and functional assays, researchers aim to clarify the biological significance of PSRC2, paving the way for potential applications in cancer therapy and beyond. Understanding the dynamics of PSRC2 at a molecular level could provide insights into its contribution to tumorigenesis and the development of targeted interventions.
