Analytical Data
-
Gene name
SLC2A1
- Application
-
Alternative Names
SLC2A1；GLUT1；Solute carrier family 2. facilitated glucose transporter member 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11166
-
Expression Region
207-271aa
-
AA Sequence
CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP
-
Molecular Weight
15.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC2A1, also known as the glucose transporter type 1 (GLUT1), is a vital transmembrane protein responsible for the facilitated transport of glucose across the plasma membrane of mammalian cells. This protein plays a crucial role in maintaining glucose homeostasis, particularly in the brain, where it is essential for neuronal function and energy metabolism. Alterations in SLC2A1 expression or function have been associated with various metabolic disorders, such as epilepsy, glucose transport deficiency, and some forms of cancer. Due to its fundamental role in physiology, SLC2A1 has garnered significant attention in biomedical research. The production of recombinant SLC2A1 protein allows for detailed structural and functional studies, facilitating the investigation of its transport mechanisms and interactions with other cellular components. By utilizing various expression systems, researchers aim to characterize the protein’s kinetics and elucidate the molecular basis of disorders linked to its dysfunction. This understanding may lead to novel therapeutic strategies for diseases associated with impaired glucose metabolism. The ongoing research on SLC2A1 emphasizes its importance in both basic science and clinical applications, highlighting the need for further investigations into its physiological roles and implications in health and disease.
