Analytical Data
-
Gene name
SFTPC
- Application
-
Alternative Names
SFTPC;SFTP2;Surfactant Protein C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11686
-
Expression Region
24-58aa
-
AA Sequence
FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
-
Molecular Weight
5.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFTPC, or Surfactant Protein C, is a key component of pulmonary surfactant, a mixture of lipids and proteins that reduces surface tension in the alveoli and plays a crucial role in lung function and host defense. Mutations in the SFTPC gene have been linked to various lung diseases, particularly surfactant dysfunction disorders such as interstitial lung diseases and surfactant metabolism disorders. Given its critical role in maintaining pulmonary health, there is growing interest in studying SFTPC as a therapeutic target and diagnostic marker. Research has focused on recombinant SFTPC proteins, which can be produced through genetic engineering techniques, enabling the exploration of their structure, function, and potential applications in treating lung diseases. By investigating the biophysical properties and interactions of recombinant SFTPC with lipids and other surfactant proteins, researchers aim to understand the mechanisms underlying surfactant metabolism and its implications for disease. Moreover, recombinant SFTPC has potential therapeutic applications in the development of novel surfactant replacement therapies for treating surfactant deficiency in neonates and adults. Additionally, understanding the kinetics of recombinant SFTPC can contribute to the design of targeted therapies for lung diseases associated with SFTPC mutations, opening new avenues for therapeutic interventions. Overall, the study of recombinant SFTPC proteins is a rapidly evolving field that combines molecular biology, biochemistry, and clinical research to address significant health challenges related to lung function and disease.











