Analytical Data
-
Gene name
PRSS3
- Application
-
Alternative Names
Brain trypsinogen; Mesotrypsin; Mesotrypsinogen; MTG; Pancreatic trypsinogen III; Protease. serine. 3; Protease. serine. 4 (trypsin 4. brain); PRSS3; PRSS4; Serine protease 3; Serine protease 4; T9; TRY3; TRY3_HUMAN; TRY4; Trypsin 3; Trypsin III; Trypsin IV; Trypsin-3; Trypsinogen 4; Trypsinogen 5; Trypsinogen IV
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35030
-
Expression Region
81-303 aa
-
AA Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN
-
Molecular Weight
28.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRSS3, or serine protease 3, is a member of the trypsin-like serine proteases family, primarily expressed in pancreatic tissues. Its role in both physiological and pathological processes has garnered significant attention in recent years. Elevated levels of PRSS3 have been associated with various conditions, including chronic pancreatitis and pancreatic cancer, indicating its potential involvement in disease progression and prognosis. Research has shown that PRSS3 can modulate inflammatory responses, contribute to cellular signaling, and may influence tumor microenvironment dynamics. Given its functional relevance, recombinant PRSS3 proteins have become valuable tools for dissecting the mechanisms underlying these processes. By enabling in-depth studies of PRSS3's enzymatic activity and interactions at a molecular level, researchers aim to uncover its precise role in pathophysiological contexts. Additionally, the development of PRSS3 inhibitors is being explored as a therapeutic strategy to mitigate its contributions to disease. Thus, the study of recombinant PRSS3 not only enriches our understanding of pancreatic biology but also holds promise for novel therapeutic interventions.
