Analytical Data
-
Gene name
GDNF
- Application
-
Alternative Names
GDNF；Glial cell line-derived neurotrophic factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UXV0
-
Expression Region
19-351aa
-
AA Sequence
SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
-
Molecular Weight
53.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GDNF, or Glial cell line-Derived Neurotrophic Factor, is a crucial neurotrophic factor that plays a significant role in the survival and maintenance of various types of neurons, particularly dopaminergic neurons. Its discovery opened new avenues for understanding neurodegenerative diseases such as Parkinson's Disease and amyotrophic lateral sclerosis (ALS). Research has demonstrated that GDNF can promote neuronal survival, enhance neurogenesis, and protect against neurotoxic damage. The recombinant production of GDNF has been a focal point of investigation, as it holds the promise for therapeutic applications, including potential neuroprotective treatments. However, the clinical application of GDNF has been limited by challenges related to effective delivery methods and stability issues in vivo. Recombinant GDNF, produced through recombinant DNA technology, offers a more reliable source for research and therapeutic development. Recent advancements in biopharmaceutical production techniques and drug delivery systems aim to improve the efficacy of GDNF in therapeutic contexts. Ongoing studies are focused on optimizing recombinant GDNF formulations, understanding its mechanisms of action, and exploring its potential in regenerative medicine and neuroprotection, highlighting its importance in combating neurodegenerative disorders. As research progresses, GDNF continues to represent a promising target for innovative treatments that could significantly improve the quality of life for patients suffering from debilitating neurological conditions.
