Analytical Data
-
Gene name
C16orf11
- Application
-
Alternative Names
PRR35; C16orf11; Proline-rich Protein 35; Uncharacterized Protein RJD1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0CG20
-
Expression Region
1-571aa
-
AA Sequence
MSREAGSCRVGTGARARSRKPKKPHYIPRPWGKPYNYKCFQCPFTCLEKSHLYNHMKYSLCKDSLSLLLDSPDWACRRGSTTPRPHAPTPDRPGESDPGRQPQGARPTGAAPAPDLVVADIHSLHCGGGPKSRAKGSPGPPPPVARATRKGPGPSGLLPESWKPGMGGDPRGVGAGDMASAGPEGSVPCYPPPAPGEFPEAHSLHLSLLGVNYPLSPGLFSYLGPSLAAAAHVPFLASASPLLPPATAFPAVQPPQRPTPAPRLYYPLLLEHTLGLPAGKAALAKAPVSPRSPSGTPAPGLLKVPVPGLGPWPRVTPRDPGQEGELERAAQSDPRRRLSLGSRLELPKASPSLTRFCSRSSLPTGSSVMLWPEDGDPGGPETPGPEGPLPLQPRGPVPGSPEHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRAPAKGPQALGEAWGRPELGPVLTGGTPEPPGMLGPAAPQPFSGHTTKCEADSSVPPPGLPLAAPDDPVIPGSGWGTCVATRSSQTPEAVCGLQSPQGAEV
-
Molecular Weight
85.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C16orf11, also known as a gene located on chromosome 16, has garnered attention in recent years due to its potential role in various biological processes and diseases. Research suggests that C16orf11 may be involved in cellular functions such as proliferation, differentiation, and apoptosis, possibly influencing cancer development and progression. Furthermore, its expression patterns have been associated with specific types of tumors, indicating its potential as a biomarker or therapeutic target. The study of C16orf11 recombinant proteins allows researchers to elucidate its functional roles and interactions in cellular pathways. By producing and purifying C16orf11 proteins, scientists can investigate their biochemical properties, characterize their interactions with other molecules, and assess their impacts on cellular functions. This research is crucial for understanding the underlying mechanisms of diseases in which C16orf11 is implicated, potentially leading to novel therapeutic strategies. Given the gene's involvement in critical cellular processes, further exploration of its recombinant protein may illuminate new avenues for cancer research and treatment, contributing to personalized medicine initiatives.
