Cat: PA1000-5049

Recombinant Human KLK11 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KLK11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KLK11;PRSS20;TLSP;Kallikrein-11

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBX7

  • Expression Region

    19-250aa

  • AA Sequence

    IIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVH LGQHNLQKEE GCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTL SSRCVTAGTS CLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASV QEGGKDSCQG DSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNNV DHHHHHH

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KLK11, or kallikrein-related peptidase 11, is a member of the kallikrein family of serine proteases, which play crucial roles in various biological processes including coagulation, inflammation, and tissue remodeling. Research on KLK11 has gained attention due to its potential implications in cancer biology, particularly in prostate cancer and ovarian cancer, where alterations in its expression levels have been correlated with disease progression and prognosis. Additionally, KLK11 has been identified as a potential biomarker for certain pathological conditions, as well as a target for therapeutic interventions. Recent advancements in recombinant protein technology have facilitated the production of KLK11 in a suitable format for functional studies, enabling researchers to explore its enzymatic activities, substrate specificities, and regulatory mechanisms. This has opened new avenues for understanding the physiological and pathological roles of KLK11, including its involvement in cell signaling pathways and its interplay with other proteases in the tumor microenvironment. As research progresses, KLK11 continues to be investigated for its full potential in clinical applications, both as a diagnostic tool and as a therapeutic target, paving the way for novel strategies in cancer treatment and precision medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US