Analytical Data
-
Gene name
MMP9
- Application
-
Alternative Names
MMP9；CLG4B；Matrix metalloProteinase-9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14780
-
Expression Region
107-707aa
-
AA Sequence
FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
-
Molecular Weight
68.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Matrix metalloproteinase-9 (MMP-9), also known as gelatinase B, is an extracellular matrix enzyme that plays a critical role in tissue remodeling and repair, inflammation, and various disease processes, including cancer metastasis and cardiovascular diseases. Its ability to degrade components of the extracellular matrix enables it to influence cellular behaviors such as migration and invasion, making it a key player in processes like angiogenesis and wound healing. Due to its significant involvement in pathological conditions, MMP-9 has become a focal point of research for therapeutic interventions. Recombination technology has enabled the production of MMP-9 as a recombinant protein, facilitating its detailed study and potential pharmaceutical applications. The recombinant form of MMP-9 can be used for various purposes, including investigating its enzymatic activity, characterizing its interactions with inhibitors, and assessing its role in disease models. Additionally, understanding MMP-9 behavior in vitro and in vivo helps to explore its potential as a biomarker for diagnosis and prognosis in numerous diseases. Thus, research on recombinant MMP-9 plays an essential role in unraveling the molecular mechanisms underlying its actions and in developing innovative treatment strategies targeting MMP-9-related pathways.
