Analytical Data
-
Gene name
SKR4
- Application
-
Alternative Names
SKR4；ALK5；SKR4；TGF-beta receptor type-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36897
-
Expression Region
80-426aa
-
AA Sequence
RDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGLPLLVQRTIARDIV LQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRH ENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLA LSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAV RHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGL VFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPN RWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM
-
Molecular Weight
66 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The SKR4 recombinant protein has emerged as a focal point of research due to its significant role in various biological processes. Initially identified in eukaryotic systems, SKR4 is implicated in cellular signaling pathways and stress responses, making it crucial for understanding cellular mechanisms and potential applications in biotechnology and medicine. Studies have shown that SKR4 exhibits unique structural and functional properties that enable it to interact with various cellular components. This interaction is vital for maintaining cellular homeostasis and resilience under stress conditions. Moreover, the ability to recombinantly produce SKR4 facilitates detailed investigations into its functional roles, enabling researchers to explore its potential as a therapeutic target or a biotechnological tool. The recombinant expression of SKR4 not only allows for the characterization of its biochemical properties but also provides insights into its evolutionary significance and functional conservation across species. Moreover, the investigation of SKR4's role in disease processes, such as cancer or neurodegenerative disorders, underscores its relevance in biomedical research. Therefore, the ongoing exploration of SKR4 recombinant protein is poised to unravel new dimensions in cell biology and therapeutic development, potentially leading to innovative strategies for disease intervention and biotechnological advancements.
