Cat: PA2000-1964

Recombinant Human DIRAS3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DIRAS3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DIRAS3;ARHI;NOEY2;RHOI;GTP-binding Protein Di-Ras3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95661

  • Expression Region

    1-229aa

  • AA Sequence

    MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

  • Molecular Weight

    52.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DIRAS3 is a member of the DIRAS family of GTPases, which play a crucial role in various cellular processes, including regulation of cell proliferation and differentiation. Research has highlighted DIRAS3 as a potential tumor suppressor, particularly in breast and ovarian cancers, where its expression is frequently downregulated. The loss of DIRAS3 expression has been correlated with poor prognosis and aggressive disease phenotypes, suggesting that it may contribute to oncogenesis through mechanisms involving cell cycle regulation and apoptosis. Investigations into the role of DIRAS3 have underscored its function in modulating signaling pathways, including those associated with the Ras family, thereby influencing cellular responses to growth factors. Additionally, DIRAS3 has been shown to affect cellular adhesion and migration, linking it to the metastatic potential of cancer cells. Given its implications in tumor biology, the recombination and functional characterization of DIRAS3 have become a focal point in cancer research, aiming to elucidate its precise molecular mechanisms and evaluate its potential as a therapeutic target. Understanding the structure-function relationship of DIRAS3 and its interactions within cellular networks may open new avenues for developing novel cancer treatments and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US