Analytical Data
-
Gene name
DIRAS3
- Application
-
Alternative Names
DIRAS3;ARHI;NOEY2;RHOI;GTP-binding Protein Di-Ras3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95661
-
Expression Region
1-229aa
-
AA Sequence
MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
-
Molecular Weight
52.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DIRAS3 is a member of the DIRAS family of GTPases, which play a crucial role in various cellular processes, including regulation of cell proliferation and differentiation. Research has highlighted DIRAS3 as a potential tumor suppressor, particularly in breast and ovarian cancers, where its expression is frequently downregulated. The loss of DIRAS3 expression has been correlated with poor prognosis and aggressive disease phenotypes, suggesting that it may contribute to oncogenesis through mechanisms involving cell cycle regulation and apoptosis. Investigations into the role of DIRAS3 have underscored its function in modulating signaling pathways, including those associated with the Ras family, thereby influencing cellular responses to growth factors. Additionally, DIRAS3 has been shown to affect cellular adhesion and migration, linking it to the metastatic potential of cancer cells. Given its implications in tumor biology, the recombination and functional characterization of DIRAS3 have become a focal point in cancer research, aiming to elucidate its precise molecular mechanisms and evaluate its potential as a therapeutic target. Understanding the structure-function relationship of DIRAS3 and its interactions within cellular networks may open new avenues for developing novel cancer treatments and improving patient outcomes.











