Cat: PA2000-1818

Recombinant Human HTR7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HTR7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HTR7;5-hydroxytryptamine receptor 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P34969

  • Expression Region

    1-479aa

  • AA Sequence

    MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLS EVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNC LVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIF GHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMA KMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYI PMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTAR PFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQ CQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVS VWVLQSPDHHNWLADKMLTTVEKKVMIHD

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HTR7, or 5-hydroxytryptamine receptor 7, is a member of the serotonin receptor family that plays a vital role in various physiological processes, including mood regulation, anxiety, and circadian rhythm. Its significance in neuropsychiatric disorders has garnered considerable research interest, especially as it is implicated in conditions like depression, schizophrenia, and anxiety disorders. The study of HTR7 recombinant proteins has emerged as a crucial aspect in understanding the receptor's function and its interactions with endogenous ligands and other cellular partners. By generating HTR7 recombinant proteins, researchers can investigate the receptor's structure-function relationship, ligand binding characteristics, and downstream signaling pathways. This enables the exploration of HTR7 as a potential therapeutic target. Advances in recombinant DNA technology and protein expression systems have facilitated the production of high-quality HTR7 proteins, which are essential for biophysical and biochemical studies. These studies are expected to offer insights into the molecular mechanisms underlying HTR7 activation and its role in signaling pathways relevant to mood regulation and stress response, ultimately contributing to the development of novel pharmacological interventions for treating neuropsychiatric disorders associated with dysregulated serotonin signaling.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US