Analytical Data
-
Gene name
BTG1
- Application
-
Alternative Names
BTG1Protein BTG1; B-cell translocation gene 1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62324
-
Expression Region
1-171aa
-
AA Sequence
MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
-
Molecular Weight
44.55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTG1 (B-cell translocation gene 1) is a member of the BTG/TOB family of proteins, which are characterized by their roles in regulating cell proliferation and differentiation. BTG1 has been implicated in various biological processes and diseases, including lymphomagenesis and oncogenesis. Given its involvement in cellular pathways, understanding the function of BTG1 at the molecular level is crucial for elucidating its role in cancer biology and potential therapeutic applications. Researchers have focused on the recombinant expression of BTG1 to investigate its biochemical properties and interactions with other proteins. Utilizing recombinant DNA technology, BTG1 can be expressed in heterologous systems, allowing for detailed studies of its structure, function, and regulatory mechanisms. Moreover, the generation of recombinant BTG1 protein enables the examination of its influence on cellular processes such as cell cycle regulation and apoptosis, providing insights into how dysregulation of this protein might contribute to tumorigenesis. By integrating findings from biochemical assays and functional studies, research on BTG1 recombinant proteins aims to forge connections between molecular mechanisms and clinical outcomes, potentially leading to novel strategies for diagnosis and treatment in cancers associated with BTG1 dysregulation.
