Analytical Data
-
Gene name
mpt64
- Application
-
Alternative Names
mpt64；Immunogenic Protein MPT64
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WIN9
-
Expression Region
24-228aa
-
AA Sequence
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
-
Molecular Weight
23.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MPT64, a key protein derived from *Mycobacterium tuberculosis*, has garnered significant attention in tuberculosis (TB) research due to its potential role in immunodiagnosis and vaccine development. This protein, with a molecular weight of approximately 64 kDa, is known for its ability to elicit robust immune responses, making it a candidate for both biomarkers and therapeutic targets. The relevance of MPT64 is underscored by the challenge posed by TB, a global health threat exacerbated by the rise of drug-resistant strains and the HIV epidemic. Current diagnostic methods, such as tuberculin skin tests and interferon-gamma release assays, have limitations in specificity and sensitivity, which MPT64 could help address. Furthermore, as researchers explore the development of novel TB vaccine candidates, MPT64's immunogenic properties are being investigated to enhance protective responses. By understanding the biological functions and mechanisms of MPT64, researchers aim to improve existing diagnostic tools and develop new vaccines, ultimately contributing to more effective strategies for TB control and eradication. The multifaceted roles of MPT64 in infection and immunity present a promising avenue for advancing TB research and improving global health outcomes.
