Analytical Data
-
Gene name
BHLHE40
- Application
-
Alternative Names
BHE40_HUMAN; bHLHB2; bHLHe40; Class B Basic Helix Loop Helix Protein 2; Class B basic helix-loop-helix Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14503
-
Expression Region
1-412aa
-
AA Sequence
MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
-
Molecular Weight
45.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BHLHE40, also known as basic helix-loop-helix family member E40, is a transcription factor that plays a crucial role in various biological processes, including circadian rhythm regulation, cellular differentiation, and metabolic control. Its involvement in the molecular mechanisms underlying these processes has drawn considerable interest from researchers, especially in the context of human health and disease. Altered expression of BHLHE40 has been implicated in various pathologies, including obesity, diabetes, and cancer, highlighting its potential as a therapeutic target. Recent studies have focused on the design and production of recombinant BHLHE40 protein to facilitate in-depth investigations of its functional properties and interactions with other cellular components. By generating and characterizing this protein, scientists aim to elucidate the precise roles of BHLHE40 in gene regulation and its impact on physiological processes. The study of recombinant BHLHE40 also opens avenues for exploring its potential as a biomarker and therapeutic target in metabolic disorders and malignancies, thereby contributing to the broader understanding of its biological significance and potential clinical applications.
