Analytical Data
-
Gene name
KIR2DL4
- Application
-
Alternative Names
KIR2DL4；CD158D；Killer cell immunoglobulin-like receptor 2DL4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99706
-
Expression Region
22-242aa
-
AA Sequence
WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVP ELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTG LYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAV PSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNP SSSWPSPTEPSFKTGIARHLHVDHHHHHH
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DL4 is a member of the Killer Immunoglobulin-like Receptor (KIR) family, which plays a crucial role in the immune system by regulating the activity of natural killer (NK) cells and some T cells. Specifically, KIR2DL4 acts as an inhibitory receptor, recognizing specific ligands, including HLA-G, a non-classical major histocompatibility complex (MHC) molecule that is often expressed in certain tissues such as the placenta. The balance between activating and inhibitory signals mediated by KIR receptors, including KIR2DL4, is vital for maintaining immune tolerance and preventing autoimmunity. Given its unique binding properties and expression pattern, KIR2DL4 has garnered interest in the context of pregnancy, transplantation, and tumor immunology. Research on recombinant KIR2DL4 protein aims to elucidate its functional mechanisms, potential therapeutic applications, and contributions to different pathological conditions. Understanding the structure and function of KIR2DL4 can provide insights into immune evasion by tumors and the modulation of immune responses in various clinical settings, paving the way for novel immunotherapeutic strategies. As such, the study of KIR2DL4 recombinant protein not only enhances our understanding of immune regulation but also holds promise for improving clinical outcomes in diseases where the immune system plays a pivotal role.
