Cat: PA2000-1697

Recombinant Human GJA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GJA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GJA1;GJAL;Gap junction alpha-1 Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P17302

  • Expression Region

    233-382aa

  • AA Sequence

    FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

  • Molecular Weight

    19.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GJA1, also known as Connexin 43 (Cx43), is a key protein in gap junctions that facilitates intercellular communication by forming channels between adjacent cells. Its role in various physiological processes, including cardiac function, cell proliferation, and differentiation, makes it a critical subject of study in cell biology and medicine. Mutations or dysregulation of GJA1 have been implicated in a variety of pathologies, including cardiac diseases, osteochondromas, and certain types of cancer. Research has increasingly focused on the recombinant expression of GJA1 to better understand its functional mechanisms and interaction with other cellular components. The production of GJA1 as a recombinant protein allows for in-depth biophysical and biochemical studies, enabling researchers to investigate its role in cell signaling and maintain overall cellular homeostasis. Additionally, insights gained from such studies can lead to novel therapeutic approaches for conditions associated with GJA1 dysfunction. As the exploration of GJA1 continues, its potential integration into gene therapy and regenerative medicine represents an exciting frontier, underlining the importance of this protein in health and disease. Understanding the structure-function relationship of GJA1 through recombinant protein studies may also pave the way for developing targeted interventions that could correct or compensate for its malfunction in various diseases. Thus, the study of GJA1 recombinant protein is not only vital for elucidating its biological significance but also for harnessing its potential in therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US