Analytical Data
-
Gene name
Il18rap
- Application
-
Alternative Names
Il18rap；TIRAP3；TIR domain-containing adapter molecule 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95256
-
Expression Region
20-356aa
-
AA Sequence
FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPE HLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVN NSGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGS TGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTY VCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPL TISCKARFGFERVFNPVIKWYIKDSDLEWEVSVPEAKSIKSTLKDEIIER NIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRVDHHHHHH
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-18 receptor accessory protein (IL18RAP) plays a crucial role in the immune response by functioning as a co-receptor for interleukin-18 (IL-18), a pro-inflammatory cytokine involved in Th1 and Th2 immune responses. The binding of IL-18 to its receptor complex, which includes IL18RAP, is essential for the activation of immune cells such as natural killer (NK) cells and T cells, leading to the promotion of various inflammatory and adaptive immune responses. Research has indicated that IL18RAP may also contribute to the pathogenesis of various inflammatory and autoimmune diseases, including rheumatoid arthritis, inflammatory bowel disease, and certain cancers. Its potential as a therapeutic target has spurred interest in the development of recombinant IL18RAP proteins, which can be utilized in both basic research and clinical applications. The recombinant proteins are being studied for their ability to modulate immune responses, evaluate their efficacy as biotherapeutics, and investigate their interactions with other cytokines and immune pathways. Understanding the biological functions of IL18RAP and its interactions with IL-18 and other components of the immune system may provide valuable insights into new treatment strategies for immune-related disorders and enhance our overall comprehension of immune regulation. This research not only holds promise for therapeutic advancements but also offers a deeper understanding of the mechanisms underlying inflammation and immunity.
