Analytical Data
-
Gene name
EFNA4
- Application
-
Alternative Names
EFNA4；EPLG4；Ephrin-A4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52798
-
Expression Region
26-171aa
-
AA Sequence
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFAL YMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFL PGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The Ephrin-A4 (EFNA4) protein plays a crucial role in various biological processes, including cell adhesion, migration, and communication in the nervous system. As a member of the ephrin family, EFNA4 interacts with Eph receptors, which are essential for neuronal development and the establishment of synaptic connections. Research has shown that dysregulation of EFNA4 and its signaling pathways may be implicated in several neurological disorders and cancers, highlighting its importance as a potential therapeutic target. Recombinant EFNA4 protein has been increasingly studied to better understand its biological functions and mechanisms of action. The production of recombinant EFNA4 allows researchers to investigate its role in cell signaling and interaction, enabling the exploration of its potential in regenerative medicine and targeted therapies. Advances in recombinant DNA technology and protein expression systems have facilitated the study of EFNA4, paving the way for novel insights into its functions and potential applications in treating diseases associated with its dysregulation.
