Analytical Data
-
Gene name
YEATS4
- Application
-
Alternative Names
YEATS4；GAS41；YEATS domain-containing Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95619
-
Expression Region
1-227aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMFKRMAEFGPDSGGRVKGVTIVKPIVY GNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNP LRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNA MLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEV KTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YEATS4 is a member of the YEATS domain-containing protein family, which has emerged as a significant player in the regulation of gene expression and chromatin remodeling. Recent studies have indicated that YEATS4 is involved in various biological processes, including transcriptional regulation and the response to environmental stimuli. Its unique YEATS domain has been shown to bind to acetylated lysines, suggesting a role in recognizing and interpreting histone modifications, which are critical for the proper functioning of chromatin. Dysregulation of YEATS4 has been implicated in several diseases, including cancer, where altered gene expression profiles can lead to tumorigenesis. Therefore, the study of YEATS4 and its recombinant protein forms is essential for understanding its molecular mechanisms and biological significance. By utilizing recombinant DNA technology, researchers aim to produce and characterize the YEATS4 protein, facilitating investigations into its structure, binding interactions, and functional roles in cellular processes. This knowledge could provide insights into the development of therapeutic strategies targeting YEATS4-related pathways in diseases where its function is compromised. The comprehensive understanding of YEATS4’s role may pave the way for novel approaches in cancer treatment and the manipulation of gene expression for therapeutic benefits.
