Analytical Data
-
Gene name
IGFBP-7
-
简介
IGFBP-7 Protein is a member of the insulin-like growth factor binding protein (IGFBP) Family. The major function of IGFBP-7 is the regulation of availability of insulin-like growth factors (IGFs) in tissue as well as in modulating IGF binding to its receptors. IGFBP7 exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. IGFBP-7 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized mouse IGFBP-7 at 0.5 μg/mL (100 μL/well) can bind biotinylated CCL21. The ED50 for this effect is 8.153 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized mouse IGFBP-7 at 0.5 μg/mL (100μL/well) can bind biotinylated CCL21. The ED50 for this effect is 8.153 ng/mL.
-
Alternative Names
IBP-7; IGFBP7; IGFBP-7v; Insulin-like growth factor binding protein 7
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
AAH92538.1
-
Expression Region
S26-L281
-
AA Sequence
SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL
-
Protein Length
Partial
-
Molecular Weight
55-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Insulin-like Growth Factor Binding Protein-7 (IGFBP-7) is a member of the IGFBP family, which plays a crucial role in regulating the bioavailability of insulin-like growth factors (IGFs) that are pivotal in cellular growth, differentiation, and metabolism. Research has indicated that IGFBP-7 exhibits multifaceted functions beyond its binding abilities, such as modulating apoptosis, playing a role in tumorigenesis, and influencing tissue repair processes. Elevated levels of IGFBP-7 have been implicated in various pathological conditions, including cancer, cardiovascular diseases, and metabolic disorders. The recombinant production of IGFBP-7 has been explored to elucidate its biological functions and therapeutic potential. By generating pure IGFBP-7 protein, researchers aim to investigate its effects on cellular pathways and its potential as a biomarker for disease prognosis or as a target for novel therapeutic strategies. Moreover, understanding the structure-function relationship of IGFBP-7 can facilitate the development of IGFBP-7-based drugs or therapies, highlighting its significance in both fundamental and clinical research. The ongoing studies into IGFBP-7's mechanisms of action continue to unravel its potential roles in health and disease, making it a compelling subject of investigation in the fields of endocrinology, oncology, and regenerative medicine.
